Protein Info for EX28DRAFT_2231 in Enterobacter asburiae PDN3

Annotation: molybdate ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 12 to 220 (209 residues), 238.6 bits, see alignment E=2.6e-75 PF00528: BPD_transp_1" amino acids 26 to 221 (196 residues), 74.8 bits, see alignment E=3.8e-25

Best Hits

Swiss-Prot: 92% identical to MODB_ECO57: Molybdenum transport system permease protein ModB (modB) from Escherichia coli O157:H7

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 96% identity to enc:ECL_02973)

MetaCyc: 92% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>EX28DRAFT_2231 molybdate ABC transporter, permease protein (Enterobacter asburiae PDN3)
MILTDPEWQAVLLSLKVSTLAVALSLPFGIFFAWLLVRCQFPGKTLLDSVLHLPLVLPPV
VVGYLLLISMGRRGFIGEKLYDWFGLTFAFSWRGAVLAAAVMSFPLMVRAIRLALEGVDM
KLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRT
IPSAMYTLIQTPGGEGAAARLCIISIVLALVSLMVSEWLARLSRERMGK