Protein Info for EX28DRAFT_2227 in Enterobacter asburiae PDN3

Annotation: HAD-superfamily hydrolase, subfamily IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 4 to 235 (232 residues), 39.5 bits, E=1.7e-13
• PF05116: S6PP
  • amino acids 4 to 65 (62 residues), 24.4 bits, E=4.1e-09
  • amino acids 158 to 247 (90 residues), 30.9 bits, E=4.1e-11
• TIGR00099: Cof-like hydrolase
  • amino acids 5 to 266 (262 residues), 213.4 bits, E=4.1e-67
• PF08282: Hydrolase_3
  • amino acids 6 to 266 (261 residues), 217.2 bits, E=6.8e-68
• TIGR01484: HAD hydrolase, family IIB
  • amino acids 6 to 240 (235 residues), 82.6 bits, E=4.4e-27

Best Hits

Swiss-Prot: 62% identical to YBHA_ECOLI: Pyridoxal phosphate phosphatase YbhA (ybhA) from Escherichia coli (strain K12)

KEGG orthology group: K07024, (no description) (inferred from 66% identity to pao:Pat9b_1157)

MetaCyc: 62% identical to pyridoxal phosphate/fructose-1,6-bisphosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Pyridoxal phosphatase. [EC: 3.1.3.74]; Fructose-bisphosphatase. [EC: 3.1.3.74, 3.1.3.11]

Predicted SEED Role

"Putative phosphatase"

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
• gluconeogenesis I (13/13 steps found)
• glycolysis I (from glucose 6-phosphate) (13/13 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• superpathway of N-acetylneuraminate degradation (19/22 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• superpathway of hexitol degradation (bacteria) (16/18 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (8/9 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• ginkgotoxin biosynthesis (1/3 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway
• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11 or 3.1.3.74

Protein Sequence (271 amino acids)

>EX28DRAFT_2227 HAD-superfamily hydrolase, subfamily IIB (Enterobacter asburiae PDN3)
MNYQVIALDLDGTLLTPEKTILPASLSALQNARKSGAKVVIVTGRHFVAIHPFYQALELN
TPAICCNGALLYDHIEKRVIASDPLRPEQATQLVNLLDSYNVHSLMYADNAMFYQEPTGH
IIRTENWAKSLPESQRPIFKQVPSLSEASQNVDAIWKFALTDSDTEKLHSFGQIVERELG
LACEWSWHDQVDIAQAGNSKGKRLAQWVESQGLSMSQVIAFGDNFNDLSMLKNAGLGVAM
GNAVAEVKECADLVIGNNTESGIAKIVNTYF