Protein Info for EX28DRAFT_2211 in Enterobacter asburiae PDN3

Annotation: Excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 TIGR00631: excinuclease ABC subunit B" amino acids 5 to 664 (660 residues), 1107.1 bits, see alignment E=0 PF04851: ResIII" amino acids 16 to 87 (72 residues), 41 bits, see alignment E=5.8e-14 PF17757: UvrB_inter" amino acids 159 to 249 (91 residues), 109.9 bits, see alignment E=1.6e-35 PF00271: Helicase_C" amino acids 434 to 545 (112 residues), 73.4 bits, see alignment E=5.4e-24 PF12344: UvrB" amino acids 552 to 593 (42 residues), 75.7 bits, see alignment 6.1e-25 PF02151: UVR" amino acids 632 to 665 (34 residues), 28.3 bits, see alignment (E = 3.3e-10)

Best Hits

Swiss-Prot: 95% identical to UVRB_ECO7I: UvrABC system protein B (uvrB) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_14465)

MetaCyc: 95% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (671 amino acids)

>EX28DRAFT_2211 Excinuclease ABC subunit B (Enterobacter asburiae PDN3)
MSKPFKLNSAFRPSGDQPEAIRRLEEGLEDGLAHQTLLGVTGSGKTFTIANVIADLQRPT
MVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDASVNEHIE
QMRLSATKALLERRDVVVVASVSAIYGLGDPDLYLKMMLHLTQGMIIDQRAIVRRLAELQ
YARNDQAFQRGTFRVRGEVIDIFPAESDDMALRVELFDEEVERLSLFDPLTGHVESVIQR
FTIYPKTHYVTPRERIVQAMEEIKVELAERRKVLLANNKLLEEQRLSQRTQFDLEMMNEL
GYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVIDESHVTIPQIGGMYRGDRARKET
LVEYGFRLPSALDNRPMKFEEFEALAPQTIYVSATPGNYELEKSGEDVVDQVVRPTGLLD
PIIEVRPVATQVDDLLSEIRARSAINERVLVTTLTKRMAEDLTEYLEEHGEKVRYLHSDI
DTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIG
RAARNVNGKAILYGDKITPSMAKAIGETERRREKQQRYNEEHGITPQGLNKKVVDILALG
QNIAKTKAKGRGKARSVVEEDTVVLTPKALQQKIHELEGQMMQHAQNLEFEEAAQIRDQL
HQLRDLFIAAS