Protein Info for EX28DRAFT_2187 in Enterobacter asburiae PDN3

Annotation: Anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF02885: Glycos_trans_3N" amino acids 5 to 68 (64 residues), 50.4 bits, see alignment E=7.8e-18

Best Hits

Swiss-Prot: 77% identical to YBIB_ECOLI: Uncharacterized protein YbiB (ybiB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to enc:ECL_02929)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase like (EC 2.4.2.18)" (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.18

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>EX28DRAFT_2187 Anthranilate phosphoribosyltransferase (Enterobacter asburiae PDN3)
MDYRKIIKEVGRGKNHARDLDHETARALYTRMLEGDVPDLEMGGILIALRIKGEGEAEMR
GFYEAMQAQTLRLTPPVAKPMPIVIPSYNGARKQANLTPQLAILLHKLGFPVVVHGVSED
PTRVLTETIFGMLGIEPTRHAGQAQAKLDGHQPVYIPVGTLCPPLEKQLDMRWRMGVRNS
AHTLAKLATPFGEDAALRLSSVSHPEYVARVGQFFEAIGGRALLMHGTEGEVYANPQRCP
QVMLIDSAGTRAVLERGEENAGVILPEAKDPHTTAHWIEQCLAGNVPVPHSIKLQMACCL
LATGEVESVQAGLERVAQAF