Protein Info for EX28DRAFT_2179 in Enterobacter asburiae PDN3

Annotation: ABC-type amino acid transport/signal transduction systems, periplasmic component/domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00497: SBP_bac_3" amino acids 26 to 244 (219 residues), 148.5 bits, see alignment E=9.4e-48 PF10613: Lig_chan-Glu_bd" amino acids 39 to 117 (79 residues), 44 bits, see alignment E=2.3e-15

Best Hits

Swiss-Prot: 95% identical to GLNH_ECOL6: Glutamine-binding periplasmic protein (glnH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10036, glutamine transport system substrate-binding protein (inferred from 100% identity to enc:ECL_02920)

MetaCyc: 95% identical to L-glutamine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamine ABC transporter, periplasmic glutamine-binding protein (TC 3.A.1.3.2)" (TC 3.A.1.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>EX28DRAFT_2179 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain (Enterobacter asburiae PDN3)
MKSVLKVSLAALTLAFAVSSQAADKLVVATDTAFVPFEFKQGDKYVGFDVDLWAAVAKEL
KLDYTLKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKADNN
DVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTP
NILYFIKTAGNGKFKAVGESLEAQQYGIAFPKGSDDLRTKVNGALKTLKENGTYNEIYKK
WFGTEPK