Protein Info for EX28DRAFT_2173 in Enterobacter asburiae PDN3

Annotation: Predicted permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details PF00892: EamA" amino acids 148 to 278 (131 residues), 66.4 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 83% identical to RHTA_SALTS: Threonine/homoserine exporter RhtA (rhtA) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: K11939, inner membrane transporter RhtA (inferred from 95% identity to enc:ECL_02918)

MetaCyc: 80% identical to L-threonine/L-homoserine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN0-0244

Predicted SEED Role

"Putative DMT superfamily metabolite efflux protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>EX28DRAFT_2173 Predicted permease, DMT superfamily (Enterobacter asburiae PDN3)
MPGLSRTSSVWLPVAVILIAMLSIQSGASLAKSLFPLVGAPGVTALRIVLGTAILVVIFK
PWRLRFKKEQRLPLLFYGLSLGAMNYLFYLSIQTIPLGIAVALEFTGPLAVALFSSRRPV
DFIWVVLAVLGLWFLLPLGQSVAEIDLTGAALALGAGACWAVYILTGQRAGEEHGPATVA
LGSLIAAIVFVPIGMAQATESIWQWSVMPIGLAVAILSTALPYSLEMIALTRLPTRIFGT
LMSMEPALAAISGMVFLGETLTLTQTLALCSIIAASMGSTLTMRPEPKVEKVDIS