Protein Info for EX28DRAFT_2167 in Enterobacter asburiae PDN3

Annotation: Multidrug resistance efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details PF00529: CusB_dom_1" amino acids 38 to 350 (313 residues), 33.6 bits, see alignment E=7.4e-12 PF13533: Biotin_lipoyl_2" amino acids 63 to 110 (48 residues), 60.5 bits, see alignment 2.6e-20 PF16576: HlyD_D23" amino acids 185 to 309 (125 residues), 59.9 bits, see alignment E=5.8e-20 PF13437: HlyD_3" amino acids 236 to 321 (86 residues), 59.5 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 97% identity to enc:ECL_02911)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>EX28DRAFT_2167 Multidrug resistance efflux pump (Enterobacter asburiae PDN3)
MAEDQNPPADEQDKNNNERKRPGKKPLIILGIVVVVMVVVALVWWFLTRNEETTDDAFTD
GDVVTIAPKTAGYVTELRVRDNQRVKKGDLLVVIDPRDTAAQRDQAQAQLGLAIAQLHQA
QAQLALSKVQYPAQRDEAKAQVLKAQADLANAQAEYRRQRGVDPRATTQQSIDSANAQLR
SAQAGLASAQAQLEVAEQVQLQIRQQETNVEARERQVDQAKAQLETANLNLSYTEVRAPF
DGVVTKRNVQPGTLVQAGTALFSLVSPNVWVVANFKESQLERMKPGDKVTVSVDAWPDME
LEGHVDSIQQGSGSRFSAFPAENATGNFVKIVQRVPVKIVIDKGLDPNKPLPLGLSVAPK
VTVE