Protein Info for EX28DRAFT_2165 in Enterobacter asburiae PDN3

Annotation: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 11 to 486 (476 residues), 403.2 bits, see alignment E=7.7e-125 PF02321: OEP" amino acids 65 to 274 (210 residues), 94.6 bits, see alignment E=3.3e-31 amino acids 306 to 484 (179 residues), 115.1 bits, see alignment E=1.8e-37

Best Hits

KEGG orthology group: None (inferred from 97% identity to enc:ECL_02909)

Predicted SEED Role

"Outer membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>EX28DRAFT_2165 efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family (Enterobacter asburiae PDN3)
MIHRRLHPLMIMMLLAGCAVGPDYQQPAPPAVTHWNDKGDSAVKSQTTSAATNPRWWKTF
GSPQLDSLVERAIAGNLTLQQTVLRIAGAREQINQAGGAFYPSVNGNLQATRQQLGLEGE
LKSHGVYDQVDSIDPNLKGALGPLTQPINLYQGSFDAQWEIDLWGKVRRQVEAAEAQQKA
AIEQRNDALVSLEAEVARAWLQLRGAQSIIATLNTQIKSAQQTLDLTESRQRGGLSPQMD
VENARAQLGNLEAQLPQYQAQERQAMNGLAILLGKPPGALDAELQSVQPMPALPDIVQTG
IPSTLARRRPDVREAEANLHAATAQIGVSVAELFPSFTLSGQFGLRNSETNWLTDWSSHF
YSFGPQVSIPIFQGGRLVSSVKVARAQQGAAVLDYRQTVLTALGDVENALVSYRTDQQRE
AGLAKTIDALQNAFDLASDSYRQGIASFIDVLDAQRQLAQAQQQRAQAQVQSALDLVALY
KALGGGWEPYQQVQLPNYSVFGDAPRG