Protein Info for EX28DRAFT_2134 in Enterobacter asburiae PDN3

Annotation: ABC-type dipeptide transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00496: SBP_bac_5" amino acids 71 to 429 (359 residues), 341.3 bits, see alignment E=3.7e-106

Best Hits

Swiss-Prot: 88% identical to GSIB_SALCH: Glutathione-binding protein GsiB (gsiB) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K13889, glutathione transport system substrate-binding protein (inferred from 98% identity to enc:ECL_02889)

MetaCyc: 86% identical to glutathione ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2); Putative hemin-binding lipoprotein" (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>EX28DRAFT_2134 ABC-type dipeptide transport system, periplasmic component (Enterobacter asburiae PDN3)
MVTFVARRWLLAASVTAALAAAPAFAAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQ
GLFGLDKEMKLKNVLAEGYTVSEDGLVYTIKLRTGVKFQDGTDFNAEAVKVNLDRASNPE
NSLKRYNLYKNIASTEVVDPATVKITLKEPFSAFINILAHPATAMISPAALKKYGKEIGF
HPVGTGPYELLTWNQTDFVKVKKFAGYWQQGLPKLDTITWRPVVDNNTRAAMLQTGEAQF
AFPIPYEQAAILQKNSKLELVASPSIMQRYISMNVTQKPFDNPKVREAINYAINRQALVK
VAFAGYATPATGVLPPAIAYAQSYQPWPYDPAKARELLKEAGFPNGFSTTLWSSHNHSTA
QKVLQFTQQQLAQVGIKVQVTAMDAGQRAAEVEGKGQKESGVRMFYTGWTASTGEADWAL
SPLFASQNWPPTLFNTAFYSNPQVDKDLADALKTTKPEEKVRLYKDAQDIIWKESPWVPL
VVEKLVSAHNKALTGFYIMPDTGFSFDDADLK