Protein Info for EX28DRAFT_2132 in Enterobacter asburiae PDN3

Annotation: ABC-type dipeptide/oligopeptide/nickel transport systems, permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 103 to 129 (27 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 222 to 247 (26 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details PF12911: OppC_N" amino acids 25 to 72 (48 residues), 57.9 bits, see alignment 7.5e-20 PF00528: BPD_transp_1" amino acids 119 to 302 (184 residues), 117 bits, see alignment E=8.8e-38

Best Hits

Swiss-Prot: 88% identical to GSID_ECO57: Glutathione transport system permease protein GsiD (gsiD) from Escherichia coli O157:H7

KEGG orthology group: K13891, glutathione transport system permease protein (inferred from 94% identity to ent:Ent638_1326)

MetaCyc: 88% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>EX28DRAFT_2132 ABC-type dipeptide/oligopeptide/nickel transport systems, permease components (Enterobacter asburiae PDN3)
MRLLNWRRQAVLNAMPGLKPDHVRTPWSEFWRRFRRQPVAMTAGLFVLLLIAVAVIAPWV
APFDAENYFDYDRLNDGPSMLHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVLIGAAIGT
VLGLVAGYYEGWWDRIIMRICDVLFAFPGILLAIAVVAIMGSGMANVIIAVAVFSIPAFA
RLVRGNTLVLKQQTFIESARSMGASDATILFSHILPGTVSSIVVYFTMRIGVSIISAASL
SFLGLGAQPPTPEWGAMLNEARADMVIAPHVAIFPSLAIFLTVLAFNLLGDGLRDALDPR
IKG