Protein Info for EX28DRAFT_2128 in Enterobacter asburiae PDN3

Annotation: Glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF02798: GST_N" amino acids 2 to 76 (75 residues), 46.4 bits, see alignment E=1e-15 PF13417: GST_N_3" amino acids 7 to 81 (75 residues), 44.2 bits, see alignment E=5.1e-15 PF13409: GST_N_2" amino acids 10 to 78 (69 residues), 46.6 bits, see alignment E=1.1e-15 PF00043: GST_C" amino acids 121 to 197 (77 residues), 34.7 bits, see alignment E=4.3e-12 PF13410: GST_C_2" amino acids 129 to 191 (63 residues), 41.1 bits, see alignment E=4.1e-14

Best Hits

Swiss-Prot: 73% identical to GSTB_SHIFL: Glutathione S-transferase GstB (gstB) from Shigella flexneri

KEGG orthology group: None (inferred from 94% identity to enc:ECL_02881)

MetaCyc: 73% identical to glutathione S-transferase GstB (Escherichia coli K-12 substr. MG1655)
RXN0-6549

Predicted SEED Role

"Uncharacterized glutathione S-transferase-like protein" in subsystem Glutathione: Non-redox reactions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>EX28DRAFT_2128 Glutathione S-transferase (Enterobacter asburiae PDN3)
MITLWGRNNSTNVKKVLWTLEELDLPFNQIMAGMSFGVNKEADYLAMNPNGLVPLLRDDE
TDATLWESNTIVRYLAAQYGQGRLWVESPARRAQGEKWMDWANQTLSPTHRVILMGLIRT
PEAERDYPAIHAAQDACENLFAMMDDELAKHAWFSGEAFGVGDIAVAPFVWNLTNMGLKW
TPRPHLERWLKQLSDRPAYRNVVMIPVT