Protein Info for EX28DRAFT_2104 in Enterobacter asburiae PDN3

Annotation: Putative inner membrane protein of Enterobacteriaceae

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details PF11045: YbjM" amino acids 4 to 117 (114 residues), 160 bits, see alignment E=1.4e-51

Best Hits

Swiss-Prot: 66% identical to YBJM_ECO57: Inner membrane protein YbjM (ybjM) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 83% identity to enc:ECL_02824)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (124 amino acids)

>EX28DRAFT_2104 Putative inner membrane protein of Enterobacteriaceae (Enterobacter asburiae PDN3)
MNIKRNWAGVISCFLLFTLVCMSLAFNVKGAFRAAGHPELGLLFFTLPGAAASFLSRKGE
VVKPLIGAMLAAPLCLLLMRMLYVSTRSFWQELAWLLSGVFWCALGALCYLFVCSLIKHR
RHHN