Protein Info for EX28DRAFT_2092 in Enterobacter asburiae PDN3

Annotation: His Kinase A (phospho-acceptor) domain/Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 180 to 202 (23 residues), see Phobius details PF00512: HisKA" amino acids 267 to 335 (69 residues), 65 bits, see alignment E=8e-22 PF02518: HATPase_c" amino acids 382 to 489 (108 residues), 76.8 bits, see alignment E=2.7e-25 PF13581: HATPase_c_2" amino acids 390 to 465 (76 residues), 31.7 bits, see alignment E=2.1e-11

Best Hits

KEGG orthology group: None (inferred from 84% identity to cko:CKO_02245)

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>EX28DRAFT_2092 His Kinase A (phospho-acceptor) domain/Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (Enterobacter asburiae PDN3)
MMRRFSLSQRLTLLFILLMMLCATVACAVQLYTSTQYGNAMVQRLSGGLAQQIVQREPIL
DAQGRVDRTALKPLFDRLMTFNPSVELYVVSPDGDILADAAPPGHIQRQKIDLAPVQTFL
SGTAIPVLGDDPRSQNKKVFSATPLRQDGELKGYLYIILQGEESNALAEMAWHKALWSTV
LWSLLWVALFGLLAGLLVWYWVTRPVKQLTVELAGLEQDSISAIRQLAAQPSDAAAKDEV
AILRNSFIELARKITRQWDQLADSDRQRREFIANISHDLRTPLTSLLGYLETLSLKAATL
TPQEHQQYLATALRQGQKVRHLSQQLFELARLEHGGIKPQRERFAMGELISDVAQKFELT
ARTREVNLHIDVPGPLPLINADVSMIERVVTNLLDNAMRHTPSGGEIRLAVWQENERLQV
EVADSGTGVDASLRDDLFQRPSALNTQASRENRGGLGLLIVKRMLELHGGGIRLMESASG
ARFRFFVPL