Protein Info for EX28DRAFT_2081 in Enterobacter asburiae PDN3

Annotation: Type II secretory pathway, component ExeA (predicted ATPase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 267 to 286 (20 residues), see Phobius details PF21327: GspA_C39-like" amino acids 325 to 425 (101 residues), 48.6 bits, see alignment E=8.9e-17 PF01471: PG_binding_1" amino acids 443 to 496 (54 residues), 23.9 bits, see alignment 3.8e-09

Best Hits

KEGG orthology group: K02450, general secretion pathway protein A (inferred from 62% identity to cko:CKO_02233)

Predicted SEED Role

"General secretion pathway protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (524 amino acids)

>EX28DRAFT_2081 Type II secretory pathway, component ExeA (predicted ATPase) (Enterobacter asburiae PDN3)
MYMRHFNFTTQPFRTITRMPGDFFVPYHQDVFGLLKEKCQTTGVTALLSDDSYLASQFCD
ALKKHDGTLLAINAFPKLSASGLLYKLNTTTKESKTRIQAIDAVLRQWKDEMLSCKTTRK
VLVISHIQSMKANCHDALSMLLTRAQELDVPLSVVLMGSADQEAALQQSGLREFLHTHHT
FRPLTCRESLSYVQAQCEEHGSDATPFTRARVRKMHVLTKGQAGKLNELAHLAMLAAWTE
RSAQVSPRHLRLAAGEVLPAKPKGKRLAVMGLFASVLFAACGWTLMPTITARLPVQLPVM
ASWKPQAPKTDAPAVPVIDNEVVNKPDAMHQLYTMWGYDATMEEALCQNAGQVNLMCKEG
SAPVEELAKEGYPWIGEIKTGDHLNYAVVARVDDNSLDLLMNNRTWQVSRSWFNQHATGN
YTQLHRLTPQGKDAVSAESSAKDLGWMDQQLSLALNLPETHTKVWTAELMQRTREFQQKM
HLHVDGIAGEDTLMQLMRETRTTPSVLIQSANISATPNAQEKHS