Protein Info for EX28DRAFT_2079 in Enterobacter asburiae PDN3

Annotation: type II secretion system protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 29 to 98 (70 residues), 81 bits, see alignment E=6.9e-27 TIGR02517: type II secretion system protein D" amino acids 29 to 580 (552 residues), 542.3 bits, see alignment E=7.6e-167 PF03958: Secretin_N" amino acids 125 to 185 (61 residues), 43 bits, see alignment 6.6e-15 amino acids 191 to 259 (69 residues), 59.3 bits, see alignment E=5.5e-20 amino acids 265 to 343 (79 residues), 62 bits, see alignment E=7.8e-21 PF00263: Secretin" amino acids 411 to 574 (164 residues), 172.6 bits, see alignment E=8.3e-55

Best Hits

Swiss-Prot: 57% identical to GSPD_AERSA: Secretin ExeD (exeD) from Aeromonas salmonicida

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 89% identity to enc:ECL_02798)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (641 amino acids)

>EX28DRAFT_2079 type II secretion system protein D (Enterobacter asburiae PDN3)
MKKFPWACVALTALSLYSGSLFAANFSASFKNTDVREFIDTVGRNLNKTILVDPSVQGTV
SVRTYNVLTEDEYYQFFLSVLDLYGLSVIPMDNGMVKVVRSSVARMSGAPIADSKNPGKG
DEVITRVVRMENVPVRELAPLLRQLNDASGIGNVVHFEPSNVLLLTGKASVVNRLVDLVQ
RVDQSGVQRREIVPLRFASAKELSDMLNNLNNEEQKGQNAPQLATKVVADDETNSLVISG
SPDARQRTRTLISQLDREQNNEGNTRVFYLKYANASKVVPVLTGIGEQLKDKAGGGKSKA
APIAGDLNISADESTNSLVITAQPNVMNSLEKVIDKLDIRRPQVLVEAIIAEVQDGNGLD
LGVQWTSKHGGVQFGSTGLPISQIKKSKVIGSYTGLATGFFNGDFGALMTALSTNGKNDI
LSTPSVVTLDNKEASFNVGQDVPVLSGSQTTSGDNVFNSVERKTVGTKLKIVPQINDGDM
IHLKIEQEVSSVDNTSTADASLGPTFNTRTINNEVMVHSGQTVVLGGLMENVTKQSVSKV
PLLGDIPVVGQLFRYTSQDSAKRNLMVFIHTTVLRDDDNYGAASKEKYEQIQARQQQRME
EHKLGIVENADSPMLPAYPSQSRAAPVSASAPVSSRNPFKE