Protein Info for EX28DRAFT_2078 in Enterobacter asburiae PDN3

Annotation: type II secretion system protein E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02533: type II secretion system protein E
  • amino acids 13 to 485 (473 residues), 682.5 bits, E=1.6e-209
• PF00437: T2SSE
  • amino acids 114 to 380 (267 residues), 364.4 bits, E=1.5e-113

Best Hits

Swiss-Prot: 62% identical to GSPE_ECOLI: Putative type II secretion system protein E (gspE) from Escherichia coli (strain K12)

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 93% identity to enc:ECL_02797)

MetaCyc: 62% identical to type II secretion system protein GspE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein E"

Protein Sequence (492 amino acids)

>EX28DRAFT_2078 type II secretion system protein E (Enterobacter asburiae PDN3)
MTEMSNALCTSTWAKENGVLFYNDEVYIREDAQAYALLEMRRVLGRSYAPTILTAEAFDE
LLTNIWQQNSGVSQQLVDDMDADIDLMALTEEIPDNEDLLDNDENSPVIRLINAIMGEAV
KEGASDIHIETFERTLSIRFRVDGVLRPVLQPARKLAPLLVSRIKVMSKLDIAEKRLPQD
GRISLRIGRKAIDVRVSTIPSQYGERVVMRLLDKSNLKPDINKLGLIDEELVKLKGLIER
PHGIILVTGPTGSGKSTTLYALLSALNGHERNILTVEDPIEYELEGVGQTQVNPRVDMTF
ARGLRAILRQDPDVVMIGEIRDGETAQIAVQASLTGHLVMSTLHTNSAAGAITRLRDMGL
ESFLIGSSLLGVIAQRLVRRLCPHCRTTSPLDDNEKALFTFMETPPKAIYRAVGCEQCRQ
SGYQGRAGIHEFLVVDSAMRRAIHEDKDEMSIETQLFKEAYSLRENGLLKVISGVTSLEE
VMRVTAERGGDA