Protein Info for EX28DRAFT_2077 in Enterobacter asburiae PDN3

Annotation: type II secretion system protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 167 to 191 (25 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 401 (398 residues), 471.4 bits, see alignment E=1.5e-145 PF00482: T2SSF" amino acids 68 to 191 (124 residues), 114 bits, see alignment E=2.2e-37 amino acids 272 to 392 (121 residues), 79 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 52% identical to GSPF_ECOLI: Putative type II secretion system protein F (gspF) from Escherichia coli (strain K12)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 88% identity to cko:CKO_02226)

MetaCyc: 52% identical to type II secretion system protein GspF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>EX28DRAFT_2077 type II secretion system protein F (Enterobacter asburiae PDN3)
MAWYAWSATDAAGKTQRGTLQAEGPKQVRQMLREQKLMPVNIAPTSDPSAGKNARKGAKL
SIPVLSMFTRQLATLVNAALPLESALKAIAKQTEDKTLAAMVSEIRDKIVEGHTLFDAFS
QFPRSFDKLYCTLVMAGEKTGHLGGVLEKLAEYNEQRQKMKSKLTQAMVYPITLTVVAIA
VISILLVAVVPQVIDQFTHMKQELPVTTRTLIAVSDFLQAWGIVIAGGLFGASASFKFWI
KVEKNRFVYHRWLLLKSPLKKLVCAINSARYIRTLSILQASSVPLLEGMYIAMDGIENLY
ARQVLEQAADTVRQGASLYNALEQARIFPPTMLYMVASGEESGELGSLMDRAAENQESAL
QHRITLTLSVFEPALVVTMATVVLFIVLSILQPLLQLNNMVG