Protein Info for EX28DRAFT_2069 in Enterobacter asburiae PDN3

Annotation: Type II secretory pathway, prepilin signal peptidase PulO and related peptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 145 to 157 (13 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 203 to 230 (28 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details PF06750: A24_N_bact" amino acids 22 to 106 (85 residues), 83.1 bits, see alignment E=1.2e-27 PF01478: Peptidase_A24" amino acids 120 to 226 (107 residues), 91.9 bits, see alignment E=3.4e-30

Best Hits

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 68% identity to enc:ECL_02788)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>EX28DRAFT_2069 Type II secretory pathway, prepilin signal peptidase PulO and related peptidases (Enterobacter asburiae PDN3)
MNPLMLLQQANLPGLCVMSGALGAILGSFLGVVAERIPPLIMEEEGAGNLLFPASHCPEC
RHALSAWENIPIISWCALRGRHCHSAIPLRLLLVEVCSALFFAASAALAPSFSALIALWL
MWSLLLPLVVIDARHMLLPDCLTQPLLWTGLMFHALFRTLPLTDAIYGAVAGYLSLWLVY
WAFRLLTGREGLGYGDFKLLAALGAWCGWQALPSIVLIAALGGIIMHCLLKPFENKNNLI
SFGPYIAFSGLVVFIAQIPHLIF