Protein Info for EX28DRAFT_2061 in Enterobacter asburiae PDN3

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details PF07681: DoxX" amino acids 19 to 98 (80 residues), 72.7 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: None (inferred from 92% identity to enc:ECL_02780)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>EX28DRAFT_2061 Predicted membrane protein (Enterobacter asburiae PDN3)
MVKSLLIAVNEKLSCDDLGKLLLRLAVGGLMLFHGLHKLFGGVGFISGMLVEKGLPGFIA
YGVLVGEVVAPVLIIVGLFTRPAALVLAFTMIVAWLMVGMGETLALDKVGAWAIESLVYF
FIGSLAVAFLGAGRFALGKAPAWR