Protein Info for EX28DRAFT_2056 in Enterobacter asburiae PDN3

Annotation: Predicted ATP-dependent endonuclease of the OLD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 PF11398: DUF2813" amino acids 1 to 375 (375 residues), 517.6 bits, see alignment E=6.2e-159 PF13175: AAA_15" amino acids 1 to 49 (49 residues), 36.8 bits, see alignment 8.7e-13 PF20469: OLD-like_TOPRIM" amino acids 376 to 440 (65 residues), 59.3 bits, see alignment E=1.1e-19

Best Hits

Swiss-Prot: 85% identical to YBJD_ECOLI: Uncharacterized protein YbjD (ybjD) from Escherichia coli (strain K12)

KEGG orthology group: K07459, putative ATP-dependent endonuclease of the OLD family (inferred from 96% identity to enc:ECL_02773)

Predicted SEED Role

"Predicted ATP-dependent endonuclease of the OLD family, YbjD subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>EX28DRAFT_2056 Predicted ATP-dependent endonuclease of the OLD family (Enterobacter asburiae PDN3)
MLLERVEIVGFRGINRLSLQLEQNNVLIGENAWGKSSLLDALTLLLSPEDDLYHFVRDDF
WFPPGDVTGREKHLHIILTFRESEPGRHRVRRFRPLSPCWVPCDDGFHRIFYRLEGEMAE
NEGVLTLRDFLDEKANPIPLDNIDDLARHLIRLTPVLRLRDARFMRRIRNGTVPNMPEVE
VTARELDFLARELVSRPQNLTDGQIRQGLSAMVQLLEHYFSEQGTSESRHRLMRRRSHDE
QRSWRYLDIINRMIDRPGGRTHRVILLGLFSTLLQAKGTVRLDRDARPLLLVEDPETRLH
PIMLSVAWHLLNLLPLQRITTTNSGELLSLTPVEHVCRLVRESSRVSAFRLGPGGLNAED
GRRIAFHIRFNRASSLFARCWLLVEGETETWVINELARQCGHHFDAEGIKVIEFAQSGLK
PLIKFARRMGIEWHVLVDGDEAGKKYASTVRSLLNNEREEERDHLTMLPAMDMEHFMYRQ
GFDDVFHRIAMVPVDVPMNMRRVIAKAIHRSSKPDLAIEVATEAGRRGVEAVPTLLRKMF
SRVLWLARGKAD