Protein Info for EX28DRAFT_2054 in Enterobacter asburiae PDN3

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 363 (323 residues), 186.7 bits, see alignment E=2.7e-59 PF16576: HlyD_D23" amino acids 47 to 294 (248 residues), 60.9 bits, see alignment E=2.2e-20 PF13533: Biotin_lipoyl_2" amino acids 62 to 108 (47 residues), 39.5 bits, see alignment 7.7e-14 PF13437: HlyD_3" amino acids 185 to 283 (99 residues), 52.5 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 83% identical to MACA_ECO57: Macrolide export protein MacA (macA) from Escherichia coli O157:H7

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 96% identity to enc:ECL_02771)

MetaCyc: 83% identical to ABC-type tripartite efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
7.6.2.-; 7.6.2.-; 7.6.2.-

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>EX28DRAFT_2054 RND family efflux transporter, MFP subunit (Enterobacter asburiae PDN3)
MNLKGKRRTLFLLLAVAILAGGYWLWQVLNAPVPQYQTLIVRPGELQQNVLATGKLDALR
KVDVGAQVSGQLKTLSVEIGDKVKKGQLLGVIDPEQAENQIREVEATLMELRAQRAQALA
ERNLAQVTLTRQQALAKTQAISKQDLDTATTELAVKQAQIGTIDAQIKRNQASLDTAKTN
LDYTKIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSTMLVKAQVSEADVIHLKPG
QNAWFTVLGDPQTRYEGVLKDILPTPEKVNDAIFYYARFEVPNPQGVLRLDMTAQVHIQL
TGVKNVLTIPLSALGESAGESRYKVKVLRNGETREREVVIGARNDTDVVVVKGLEEGEEV
VVSESLPGAAK