Protein Info for EX28DRAFT_2053 in Enterobacter asburiae PDN3

Annotation: ABC-type antimicrobial peptide transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 transmembrane" amino acids 271 to 291 (21 residues), see Phobius details amino acids 521 to 546 (26 residues), see Phobius details amino acids 570 to 599 (30 residues), see Phobius details amino acids 606 to 629 (24 residues), see Phobius details PF00005: ABC_tran" amino acids 24 to 172 (149 residues), 114.4 bits, see alignment E=9.3e-37 PF12704: MacB_PCD" amino acids 270 to 489 (220 residues), 151.2 bits, see alignment E=7.7e-48 PF02687: FtsX" amino acids 525 to 639 (115 residues), 67.5 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 86% identical to MACB1_ECOK1: Macrolide export ATP-binding/permease protein MacB 1 (macB1) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 98% identity to enc:ECL_02770)

MetaCyc: 86% identical to ABC-type tripartite efflux pump ATP binding/membrane subunit (Escherichia coli K-12 substr. MG1655)
7.6.2.-; 7.6.2.-; 7.6.2.-

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (646 amino acids)

>EX28DRAFT_2053 ABC-type antimicrobial peptide transport system, ATPase component (Enterobacter asburiae PDN3)
MRALLELNNIRRSYPSGDGPVEVLKGISLRVEAGEMVAIVGASGSGKSTLMNILGCLDKP
TSGTYRVAGTDVSTLDGDALAKLRREHFGFIFQRYHLLSHLNAAQNVEVPAVYAGVERKK
RLERAQMLLTRLGLAERVEYQPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG
EEVMAILHQLRDQGHTVIIVTHDPQVAAQAERIIEIHDGELVSNPPPRESRAAAPKEVLP
ASTGWGQFSSGFREALTMAWLAMAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQLVLA
DIRAIGTNTIDVYPGKDFGDDEPQYQQALKYDDLAAIQKQPWVNSATPAVSQNLRLRVGN
VDVAASANGVSGDYFNVYGMTFSEGATFNAEQLAGRAQVVVLDANSRRQLFPNKANVVGE
VILVGNMPATVIGVAEEKQSMFGSSKILRVWLPYTTISGRIMGQSWLNSITVRVKEGYDS
ALAEQQLERLLTLRHGKKDFFTWNMDGLLKTAEKTTRTLQLFLTLVAVISLVVGGIGVMN
IMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGAMGIALSMMIAFALQLFL
PGWEIGFSPVAIITAFLCSTFTGILFGWLPARNAARLDPVDALARE