Protein Info for EX28DRAFT_2035 in Enterobacter asburiae PDN3

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 316 (306 residues), 98.7 bits, see alignment E=5.1e-32 amino acids 211 to 376 (166 residues), 59.3 bits, see alignment E=5e-20 PF06779: MFS_4" amino acids 27 to 362 (336 residues), 37.6 bits, see alignment E=2.6e-13 PF00083: Sugar_tr" amino acids 39 to 177 (139 residues), 25.3 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 95% identical to Y1421_ENT38: Uncharacterized MFS-type transporter Ent638_1421 (Ent638_1421) from Enterobacter sp. (strain 638)

KEGG orthology group: K08219, MFS transporter, UMF2 family, putative MFS family transporter protein (inferred from 98% identity to enc:ECL_02753)

Predicted SEED Role

"Hypothetical MFS-type transporter protein YcaD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>EX28DRAFT_2035 Arabinose efflux permease (Enterobacter asburiae PDN3)
MTTYTRPVLLLLCGLLLLTLAIAVLNTLVPLWLAHENLPTWQVGMVSSSFFTGNLLGTLL
TGSLIKRFGFNRSYYLASLIFAAGCAGLGLMVGFWSWMAWRFIAGVGCAMIWVVVESALM
CSGTSRNRGRLLAAYMMVYYVGTVLGQLMVSKLPTDLMSVLPWVTGMVLAAILPLLFTRI
VNQNSEHQKATHVWPMLRLRQARLGVNGCIISGIVLGSLYGLMPLYLNHQGVSDSGIGFW
MAVMVSAGIVGQWPIGRLADRFGRLLVLRVQVFVVIMGCLAMLSNAAMAPALFILGAAGF
TLYPVAMAWACEKVEHHQLVAMNQALLLSYTIGSLLGPTFTAMLMQNYSDNLLFIMIASV
SFIYLLMLLRKVGEHPTPVAHA