Protein Info for EX28DRAFT_2031 in Enterobacter asburiae PDN3

Annotation: formate transporter FocA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 163 to 192 (30 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details TIGR04060: formate transporter FocA" amino acids 108 to 373 (266 residues), 418.5 bits, see alignment E=9.7e-130 PF01226: Form_Nir_trans" amino acids 109 to 370 (262 residues), 259.2 bits, see alignment E=1.7e-81 TIGR00790: formate/nitrite transporter" amino acids 120 to 374 (255 residues), 316.6 bits, see alignment E=1.1e-98

Best Hits

KEGG orthology group: K06212, formate transporter (inferred from 88% identity to ecc:c1042)

Predicted SEED Role

"Formate efflux transporter (TC 2.A.44 family)" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>EX28DRAFT_2031 formate transporter FocA (Enterobacter asburiae PDN3)
MGKYNNIYLGFTVTFYGKYSILINCVRGGRTKNSTLFITFKIYFYTDNQLLTPHLLXNHT
HCGPISQARYDLYQFLFYNALLVSRRRLNKERVSVKADNPFDLLLPAAMAKVAEEAGVYK
ATKHPMKTFYLAITAGVFISIAFVFYITATTGTAGMPFGMAKLIGGICFSLGLILCVICG
ADLFTSTVLIVVAKASGRITWGQLARNWLNVYVGNLVGCLLFVLLMWLSGEYMTANGGWG
LNVLQTADHKMHHTFIEAVALGILANLMVCLAVWMSYSGRSLMDKALIMVLPVAMFVASG
FEHSIANMFMIPMGIVIRDFASPEFWTAVGSSPESFSHLTIMNFITDNLIPVTIGNIIGG
GLLVGLTYWVIYLRGDDHH