Protein Info for EX28DRAFT_2025 in Enterobacter asburiae PDN3

Annotation: ribosomal protein S1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 TIGR00717: ribosomal protein bS1" amino acids 3 to 520 (518 residues), 797.8 bits, see alignment E=1.9e-244 PF00575: S1" amino acids 19 to 78 (60 residues), 29.8 bits, see alignment 1.3e-10 amino acids 103 to 171 (69 residues), 38.8 bits, see alignment E=2e-13 amino acids 190 to 260 (71 residues), 77.9 bits, see alignment E=1.2e-25 amino acids 275 to 347 (73 residues), 70.9 bits, see alignment E=1.9e-23 amino acids 361 to 434 (74 residues), 78.2 bits, see alignment E=1e-25 amino acids 449 to 520 (72 residues), 61.7 bits, see alignment E=1.4e-20 PF23459: S1_RRP5" amino acids 189 to 258 (70 residues), 27.1 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 99% identical to RS1_ECO57: 30S ribosomal protein S1 (rpsA) from Escherichia coli O157:H7

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 100% identity to enc:ECL_02743)

MetaCyc: 99% identical to 30S ribosomal subunit protein S1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (557 amino acids)

>EX28DRAFT_2025 ribosomal protein S1 (Enterobacter asburiae PDN3)
MTESFAQLFEESLKTIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGEL
EIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEKAYEEAETVVGVINGKVKGGF
TVELNGIRAFLPGSLVDVRPVRDTLHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENSA
ERDQLLENLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDE
ITVKVLKFDRERTRVSLGLKQLGEDPWVAIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGV
EGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERRRISLGLKQCKNNPWQQFAET
HNKGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWNVAGEEAVREYKKGDEIAAVVL
QVDAERERISLGVKQLAEDPFNNWVALNKKGAIVNGKVTAVDAKGATVELADGVEGYLRA
SEASRDRVEDATLVLNVGDDVEAKFTGVDRKNRAISLSVRAKDEADEKDAIATVNKQEDA
NFSNNAMAEAFKAAKGE