Protein Info for EX28DRAFT_1975 in Enterobacter asburiae PDN3

Annotation: Raf kinase inhibitor-like protein, YbhB/YbcL family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00481: Raf kinase inhibitor-like protein, YbhB/YbcL family" amino acids 43 to 183 (141 residues), 171.2 bits, see alignment E=5.7e-55 PF01161: PBP" amino acids 47 to 183 (137 residues), 150.9 bits, see alignment E=1.4e-48

Best Hits

Swiss-Prot: 62% identical to YBCL_ECOLI: UPF0098 protein YbcL (ybcL) from Escherichia coli (strain K12)

KEGG orthology group: K06910, (no description) (inferred from 65% identity to sea:SeAg_B1039)

Predicted SEED Role

"Phospholipid-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>EX28DRAFT_1975 Raf kinase inhibitor-like protein, YbhB/YbcL family (Enterobacter asburiae PDN3)
MKKRSVIAIAALATMSFQVLATTPFGVTSRDISFEKRLAQQQVFEGFGCHGGNISPQLAW
KNPPAGTKSFAVTVYDPDAPTGSGWWHWTVANIPAKTMTLPADAGNPNGEKLPAGVVQGR
NDFGYSGFGGACPPEGDKPHRYQITVWALDVDKLPVDNNASGALVGFMLNSHVLAKAQLT
ATYSR