Protein Info for EX28DRAFT_1964 in Enterobacter asburiae PDN3

Annotation: Integral membrane protein, interacts with FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details PF01027: Bax1-I" amino acids 19 to 213 (195 residues), 158.1 bits, see alignment E=1.4e-50

Best Hits

Swiss-Prot: 94% identical to YCCA_ECOLI: Modulator of FtsH protease YccA (yccA) from Escherichia coli (strain K12)

KEGG orthology group: K06890, (no description) (inferred from 94% identity to eco:b0970)

Predicted SEED Role

"Putative TEGT family carrier/transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>EX28DRAFT_1964 Integral membrane protein, interacts with FtsH (Enterobacter asburiae PDN3)
MDRIITSSRDRTSLLSTHKVLRNTYFMLSLTLAFSAITATASTVLMLPSPGLILTLVGMY
GLMFLTYKTADKPVGILSAFAFTGFLGYILGPMLNAYLSAGMGDLIGMALGGTALVFFCC
SAYVLTTRKDMSFLGGMLMAGVVVVLVGMVANIFLQLPALHLAISAVFILISSGAILFET
SNIIRGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD