Protein Info for EX28DRAFT_1958 in Enterobacter asburiae PDN3

Annotation: AMP-binding enzyme C-terminal domain/AMP-binding enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 180 to 201 (22 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details PF00501: AMP-binding" amino acids 125 to 338 (214 residues), 133.7 bits, see alignment E=7.6e-43 PF13193: AMP-binding_C" amino acids 392 to 464 (73 residues), 28.3 bits, see alignment E=2.7e-10

Best Hits

KEGG orthology group: K03367, D-alanine--poly(phosphoribitol) ligase subunit 1 [EC: 6.1.1.13] (inferred from 84% identity to pwa:Pecwa_1365)

Predicted SEED Role

"D-alanine--poly(phosphoribitol) ligase subunit 1 (EC 6.1.1.13)" in subsystem D-Alanyl Lipoteichoic Acid Biosynthesis or Methicillin resistance in Staphylococci or Streptococcus pyogenes Virulome or Teichoic and lipoteichoic acids biosynthesis (EC 6.1.1.13)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.13

Use Curated BLAST to search for 6.1.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>EX28DRAFT_1958 AMP-binding enzyme C-terminal domain/AMP-binding enzyme (Enterobacter asburiae PDN3)
MKNHSDLQELQDFLRAALCDPASPQQLAISGSDEALSWLQLSAAVTDWAQRYQRCQPVAG
TPVVLYGHQQAEFAVAIYSCLLHNIPYIPVDCIYPQERLREICHLASAPYYYDVATRQFI
ATGEPGKVLEEQDLAYIMFTSGSTGKPKGVQIGRESVWHFMKWVSQDFSLPEKPVLMNHA
VFSFDLSLIPLLANLAMGGHIVLNAKEDIQKENWLERLKSNAVSAWVSTPSFAYQQLLSP
QFNSEYLPALNVFIFIGEVLNKALVKQLRRRFPQAKIINSYGPTEATIATTVVEITDAIL
NSDSAVLPVGVMMPESKMEISADGELIIWGKNVMRGYLGLPQENAAKLLGREDEAFRGYR
TGDLGYEAGLIYCQGRNDSQVKLNGYRIEINEIENRLLAMSGINEAVVLPLMKSCGSVLR
IAAFCVTDMAPDTIKTSLSKVVPHYMVPSQIIVKDALPLNPNGKIDRKLLDAYARTN