Protein Info for EX28DRAFT_1951 in Enterobacter asburiae PDN3

Annotation: 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 3 to 336 (334 residues), 89.6 bits, E=6.1e-29
• PF00890: FAD_binding_2
  • amino acids 3 to 35 (33 residues), 21.8 bits, 2.4e-08
• PF13450: NAD_binding_8
  • amino acids 5 to 31 (27 residues), 27.9 bits, see alignment (E = 5.7e-10)

Best Hits

Swiss-Prot: 84% identical to HPXO_KLEOX: FAD-dependent urate hydroxylase (hpxO) from Klebsiella oxytoca

KEGG orthology group: None (inferred from 94% identity to enc:ECL_02668)

MetaCyc: 81% identical to FAD-dependent urate hydroxylase (Klebsiella pneumoniae)
RXN-11186 [EC: 1.14.13.113]

Predicted SEED Role

"Salicylate hydroxylase (EC 1.14.13.1)" in subsystem Salicylate and gentisate catabolism or Salicylate ester degradation (EC 1.14.13.1)

MetaCyc Pathways

• urate conversion to allantoin II (3/3 steps found)
• methylsalicylate degradation (2/2 steps found)
• salicylate degradation I (1/1 steps found)
• chlorosalicylate degradation (2/7 steps found)
• superpathway of salicylate degradation (2/7 steps found)
• naphthalene degradation to acetyl-CoA (2/12 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (8/42 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Bile acid biosynthesis
• Fluorene degradation
• Naphthalene and anthracene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.1 or 1.14.13.113

Protein Sequence (384 amino acids)

>EX28DRAFT_1951 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases (Enterobacter asburiae PDN3)
MRAIVIGAGIGGLSAAVALKKAGIDCTVFEAVKEIRPVGAAISIWPNGVKCMQHLGMGDI
IETYGGPMRFMAYKDYRRGETLTRFSLAPLVERTGGRPCPVSRAELQREMLDFWGRDKVQ
FGKRVERVSEDGAGLSVTFTDGTTASGDFLIAADGSHSAVRPYVLGYTPERRYAGYVNWN
GLVKIDEEIAPAHQWTTFVGEGKRVSLMPVSGGRFYFFFDVPLPAGLAEDRTTLRADLSG
YFRGWAPPVQKLIAALDPETTNRIEIHDIEPFDSLVRGNVALLGDAAHSTTPDIGQGGCA
AMEDAVVLGECLLENHSITLALRQYEALRCDRVRDLVLKARKRCDVTHGKDMALTQAWYQ
ELKEETGERIINGLCETIQGGPLG