Protein Info for EX28DRAFT_1949 in Enterobacter asburiae PDN3

Annotation: hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02962: hydroxyisourate hydrolase
  • amino acids 2 to 107 (106 residues), 91.5 bits, E=2.2e-30
• PF00576: Transthyretin
  • amino acids 4 to 106 (103 residues), 93.1 bits, E=7.8e-31

Best Hits

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 86% identity to enc:ECL_02666)

MetaCyc: 64% identical to hydroxyisourate hydrolase (Klebsiella michiganensis M5al)
Hydroxyisourate hydrolase. [EC: 3.5.2.17]

Predicted SEED Role

"5-Hydroxyisourate Hydrolase (HIUase) (EC 3.5.2.17)" (EC 3.5.2.17)

MetaCyc Pathways

• ureide biosynthesis (6/7 steps found)
• urate conversion to allantoin I (3/3 steps found)
• urate conversion to allantoin II (3/3 steps found)
• urate conversion to allantoin III (2/3 steps found)
• superpathway of purines degradation in plants (11/18 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.17

Use Curated BLAST to search for 3.5.2.17

Protein Sequence (107 amino acids)

>EX28DRAFT_1949 hydroxyisourate hydrolase (Enterobacter asburiae PDN3)
MSTLSTHILDISTGKPAEGVTVHLQQDGNTLATGVTNAQGRIAAFVPSLPAGRYRLVAEI
GAWFSETGRDTLYPCAQIDFVTGEAAGEHFHLPFVIAPGGWSTYRGS