Protein Info for EX28DRAFT_1947 in Enterobacter asburiae PDN3

Annotation: Cytosine/uracil/thiamine/allantoin permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 41 to 64 (24 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 108 to 118 (11 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 316 to 340 (25 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 380 to 404 (25 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details amino acids 460 to 476 (17 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 32 to 465 (434 residues), 293.1 bits, see alignment E=1.8e-91

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 97% identity to enc:ECL_02664)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>EX28DRAFT_1947 Cytosine/uracil/thiamine/allantoin permeases (Enterobacter asburiae PDN3)
MPNSQNAQQGTAADSGAVYSPRLCNEDLAPTRDQNWSWYNIFSFWMSDVHSMGGYVVAAS
FFTLGLASWQVLLCLLVGICIVQLCANLVAKPSQMAGVPYAVISRQAFGVFGANIPAVIR
GLIAFAWYGIQTYLAANALMLVALKFWPSLSSLTTGAFLGLSHLGWICFAIMWVLQAMVF
WHGMSAIKRFIDIAGPAVYVVMLALAGWIVYKTGFDGISFTLASKSLSAGEQTWQMITAT
ALVVSYFSGPLLNFGDFSRYGKSMGEIRRGNRWGLPFNFLLFSIVTVVIVSGTQSLFGRM
ITDPIETVSRVGNDLAVAIGLLTMITATIGINIVANFVSPAFDFSNCSPQKISFRTGGMI
AAVGSILLTPWNLFNSPELIHYTLDVLGAFIGPLFGILIADFYLIKRGKVSVDDLFDDTP
KGKYWYRNGFNPKAIGALIPSVAVGLVISFIPALHEVANFSWFIGVFLGGVTYRWLARED
RETAGATSFSSRVATQKE