Protein Info for EX28DRAFT_1918 in Enterobacter asburiae PDN3

Annotation: Nitroreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00881: Nitroreductase" amino acids 25 to 174 (150 residues), 54 bits, see alignment E=1.2e-18

Best Hits

Swiss-Prot: 88% identical to RUTE_ENT38: Probable malonic semialdehyde reductase RutE (rutE) from Enterobacter sp. (strain 638)

KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 94% identity to enc:ECL_02626)

MetaCyc: 85% identical to putative malonic semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
RXN-8974 [EC: 1.1.1.298]

Predicted SEED Role

"Predicted reductase RutE in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.298

Use Curated BLAST to search for 1.-.-.- or 1.1.1.298

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>EX28DRAFT_1918 Nitroreductase (Enterobacter asburiae PDN3)
MSEAITPAALETLFTGARTHNGWLDMPVSDETLREIYNLMKWGPTSANCSPARIVFVRSA
EGKEKLRPALSSGNLEKTLTAPVTAIVAWDGEFYERLPELFPHGDAKSWFTTSPAHAEET
AFRNSSMQAAYLIFACRALGLDTGPMSGFDRQKVDEAFFTGTTLKSNLLINIGYGDTRKL
YGRLPRLDFDDACGLA