Protein Info for EX28DRAFT_1916 in Enterobacter asburiae PDN3

Annotation: pyrimidine utilization protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03610: pyrimidine utilization protein C
  • amino acids 1 to 127 (127 residues), 251.3 bits, E=8e-80
• PF01042: Ribonuc_L-PSP
  • amino acids 14 to 125 (112 residues), 115.5 bits, E=7.4e-38

Best Hits

Swiss-Prot: 98% identical to RUTC_ENTCC: Putative aminoacrylate peracid reductase RutC (rutC) from Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56)

KEGG orthology group: K09021, UPF0076 protein RutC (inferred from 98% identity to enc:ECL_02624)

MetaCyc: 88% identical to 3-aminoacrylate deaminase (Escherichia coli K-12 substr. MG1655)
RXN0-6452

Predicted SEED Role

"Bona fide RidA/YjgF/TdcF/RutC subgroup"

MetaCyc Pathways

• uracil degradation III (5/5 steps found)

Protein Sequence (128 amino acids)

>EX28DRAFT_1916 pyrimidine utilization protein C (Enterobacter asburiae PDN3)
MPKSVIIPPGTSTPIAPFVPGTLADGVVYVSGTLPFDKDNNVVFINDPKAQTRHVLETIK
TVIETAGGTMEDVTFNSIFITDWKNYAAINEIYAEFFPGDKPARFCIQCGLVKPEALVEI
ATVAHIAK