Protein Info for EX28DRAFT_1910 in Enterobacter asburiae PDN3

Annotation: sodium/proline symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 45 to 53 (9 residues), see Phobius details amino acids 59 to 61 (3 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 325 to 350 (26 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details amino acids 403 to 422 (20 residues), see Phobius details amino acids 429 to 449 (21 residues), see Phobius details amino acids 455 to 473 (19 residues), see Phobius details TIGR02121: sodium/proline symporter" amino acids 6 to 490 (485 residues), 771 bits, see alignment E=4.8e-236 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 35 to 437 (403 residues), 434.5 bits, see alignment E=4.4e-134 PF00474: SSF" amino acids 35 to 437 (403 residues), 482.6 bits, see alignment E=5e-149

Best Hits

Swiss-Prot: 94% identical to PUTP_ECOLI: Sodium/proline symporter (putP) from Escherichia coli (strain K12)

KEGG orthology group: K11928, sodium/proline symporter (inferred from 98% identity to enc:ECL_02618)

MetaCyc: 94% identical to proline:Na+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-118; TRANS-RXN0-505

Predicted SEED Role

"Proline/sodium symporter PutP (TC 2.A.21.2.1) @ Propionate/sodium symporter" (TC 2.A.21.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>EX28DRAFT_1910 sodium/proline symporter (Enterobacter asburiae PDN3)
MAISTPMLVTFLVYIFGMILIGFLAWRSTKNFDDYILGGRSLGPMVTALSAGASDMSGWL
LMGLPGAIFISGISESWIAIGLTLGAWINWKLVAGRLRVHTEANNNALTLPDYFTGRFED
NSRILRIISAVVILLFFTIYCASGIVAGARLFESTFGMSYETALWAGAAATILYTFVGGF
LAVSWTDTVQASLMIFALILTPVIVIFTVGGFGESLEVIKQKSIENVDMLKGLNFVAIVS
LMGWGLGYFGQPHILARFMAADSHHTIVHARRISMTWMILCLAGACAVGFFGIAYFNNNP
AQAGAVNQNAERVFIELAQILFNPWIAGILLSAILAAVMSTLSCQLLVCSSAITEDLYKA
FLRKNASQKELVWVGRFMVLVVALIAIALAANPNNRVLGLVSYAWAGFGAAFGPVVLFSV
LWSRMTRNGALAGMIIGAVTVIVWKQFAWLGLYEIIPGFIFGSIGIVVFSLLGKAPSASM
QKRFAEADAHYHTAPPSKLQAE