Protein Info for EX28DRAFT_1905 in Enterobacter asburiae PDN3

Annotation: Tat-translocated enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details TIGR01412: Tat-translocated enzyme" amino acids 6 to 426 (421 residues), 581.6 bits, see alignment E=1.3e-178 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 13 to 39 (27 residues), 18.5 bits, see alignment (E = 3e-07) TIGR01413: Dyp-type peroxidase family" amino acids 65 to 414 (350 residues), 341.3 bits, see alignment E=8.9e-106 PF04261: Dyp_perox_N" amino acids 65 to 217 (153 residues), 149.7 bits, see alignment E=6e-48 PF20628: Dyp_perox_C" amino acids 231 to 413 (183 residues), 179.3 bits, see alignment E=5.4e-57

Best Hits

Swiss-Prot: 84% identical to EFEB_ECOL5: Deferrochelatase/peroxidase EfeB (efeB) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 95% identity to enc:ECL_02613)

MetaCyc: 83% identical to heme-containing peroxidase/deferrochelatase (Escherichia coli K-12 substr. MG1655)
PROTOHEMEFERROCHELAT-RXN [EC: 4.98.1.1]

Predicted SEED Role

"Ferrous iron transport peroxidase EfeB"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.98.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>EX28DRAFT_1905 Tat-translocated enzyme (Enterobacter asburiae PDN3)
MNKHSENDVVEPSRRRLLKGVGALGGALVLAGGCPVAHAAKPQSAPGTLSPNARMETQPF
YGEHQSGILTPQQASMMLVAFDSLASDKADLERLFRLLTTRIAFLTAGGPAPDTPNPRLP
PMDSGILGPFIAPDNLTITVSLGESLFHARYGLAKQKPKALQKMTRFPNDSLDAALCHGD
LLLQICANTQDTVIHALRDIIKHTPDLLSVRWKREGFISDHAARSKGKETPVNLLGFKDG
TANPDSHDGALMKEVVWVTADQGEPAWAVGGSYQAVRIIQFHVEFWDRTPLKEQQTIFGR
DKQSGAPLGMKNEHDVPDYVSDPNGDTIALDSHIRLANPRTIETQSSLMMRRGYSYSLGV
TNSGQLDMGLLFVCYQHDLEKGFLTVQKRLNGEALEEYIKPIGGGYFFALPGVRDRNAYL
AQGLIEA