Protein Info for EX28DRAFT_1900 in Enterobacter asburiae PDN3

Annotation: Pirin-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF02678: Pirin" amino acids 20 to 127 (108 residues), 116.7 bits, see alignment E=5.2e-38 PF05726: Pirin_C" amino acids 182 to 284 (103 residues), 118.8 bits, see alignment E=1.3e-38

Best Hits

Swiss-Prot: 61% identical to Y2418_PSEAE: Putative quercetin 2,3-dioxygenase PA2418 (PA2418) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06911, (no description) (inferred from 90% identity to enc:ECL_02609)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>EX28DRAFT_1900 Pirin-related protein (Enterobacter asburiae PDN3)
MKNVTGVYTAPRQHWVGDGFPVRSMFSYQTHGEPLSPFLLLDYAGPYTFPADGAKRGVGQ
HPHRGFETVTIVYSGEVEHRDSTGKGGVIGPGDVQWMTAGAGILHEEFHSSAFSQKGGEL
KMMQLWVNLPAKDKMAAPGYQSITKNAIPTVTLPDNSGSLRVIAGRYEAVTGPAHTFSPL
NVWDIALNQGSHLTLNQPEGWSTALVVLEGNITVNGTTQAGEAQLVVLSQEGDKLHMEAN
SDAKVLLMAGEPLNEPIVGYGPFVMNSKSEINEAIRDFNSGRFGQI