Protein Info for EX28DRAFT_1900 in Enterobacter asburiae PDN3
Annotation: Pirin-related protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 61% identical to Y2418_PSEAE: Putative quercetin 2,3-dioxygenase PA2418 (PA2418) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K06911, (no description) (inferred from 90% identity to enc:ECL_02609)Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (286 amino acids)
>EX28DRAFT_1900 Pirin-related protein (Enterobacter asburiae PDN3) MKNVTGVYTAPRQHWVGDGFPVRSMFSYQTHGEPLSPFLLLDYAGPYTFPADGAKRGVGQ HPHRGFETVTIVYSGEVEHRDSTGKGGVIGPGDVQWMTAGAGILHEEFHSSAFSQKGGEL KMMQLWVNLPAKDKMAAPGYQSITKNAIPTVTLPDNSGSLRVIAGRYEAVTGPAHTFSPL NVWDIALNQGSHLTLNQPEGWSTALVVLEGNITVNGTTQAGEAQLVVLSQEGDKLHMEAN SDAKVLLMAGEPLNEPIVGYGPFVMNSKSEINEAIRDFNSGRFGQI