Protein Info for EX28DRAFT_1895 in Enterobacter asburiae PDN3

Annotation: Histidinol phosphatase and related hydrolases of the PHP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF02811: PHP" amino acids 5 to 80 (76 residues), 37.4 bits, see alignment E=1.6e-13

Best Hits

Swiss-Prot: 90% identical to Y1550_ENT38: Probable phosphatase Ent638_1550 (Ent638_1550) from Enterobacter sp. (strain 638)

KEGG orthology group: K04477, putative hydrolase (inferred from 98% identity to enc:ECL_02606)

Predicted SEED Role

"Putative hydrolase YcdX (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>EX28DRAFT_1895 Histidinol phosphatase and related hydrolases of the PHP family (Enterobacter asburiae PDN3)
MYPVDLHMHTVASTHAYSNLHDYIAQAKLKGIKLFAITDHGPDMADAPHYWHFVNMRIWP
RLVDGIGILRGIEANIKNTDGEIDCTGPMLTSLDLILAGFHEPVFPPQDKETNTAAMIAT
IASGNVHIISHPGNPRYPIDIQAVAQAAAKHRVALEINNSSFVHSRKGSEANCREVAAAV
RDAGGMVALGSDSHTAFTLGDFSECLKVLNDVNFPEAQILNVTPRRMLDFLESRGMEPIA
EFADL