Protein Info for EX28DRAFT_1878 in Enterobacter asburiae PDN3

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 218 to 242 (25 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 261 (244 residues), 123.3 bits, see alignment E=1.7e-39 amino acids 222 to 399 (178 residues), 84.9 bits, see alignment E=8.3e-28 PF12832: MFS_1_like" amino acids 22 to 364 (343 residues), 52.3 bits, see alignment E=7.7e-18 PF00083: Sugar_tr" amino acids 47 to 217 (171 residues), 34.1 bits, see alignment E=2.3e-12 amino acids 256 to 394 (139 residues), 27.1 bits, see alignment E=2.9e-10

Best Hits

Swiss-Prot: 91% identical to MDTG_SALPB: Multidrug resistance protein MdtG (mdtG) from Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

KEGG orthology group: K08161, MFS transporter, DHA1 family, multidrug resistance protein (inferred from 97% identity to enc:ECL_02586)

MetaCyc: 88% identical to efflux pump MdtG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-342; TRANS-RXN0-589

Predicted SEED Role

"Multidrug-efflux transporter, major facilitator superfamily (MFS) (TC 2.A.1)" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>EX28DRAFT_1878 Arabinose efflux permease (Enterobacter asburiae PDN3)
MSPSDAPINWKRNLTVAWLGCFLTGAAFSLVMPFLPLYVEQLGVTGHSALNMWSGLVFSI
TFLFSAMASPFWGGLADRKGRKIMLLRSALGMAIIMALMGVAQNVWQFLILRALLGLLGG
FIPNANALIATQIPRHKSGWALGTLSTGGVSGALLGPLAGGLLADNYGLRPVFFITASVL
FLCFIVTLLCIRENFTPVAKKEMLHAREVLTSLKNPRLVLSLFVTTMIIQVATGSIAPIL
TLYVRDLAGNVSNIAFISGLIASVPGVAALLSAPRLGKLGDRVGPEKILICALVISVLLL
IPMSMVQTPWQLGVLRFLLGAADGALLPAVQTLLVYNSTNQIAGRIFSYNQSFRDIGNVT
GPLLGAGISASFGFRAVFIVTAGVVLFNAIYSWFSLSRALRPVTE