Protein Info for EX28DRAFT_1876 in Enterobacter asburiae PDN3

Annotation: Predicted sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF17773: UPF0176_N" amino acids 25 to 117 (93 residues), 78.8 bits, see alignment E=4.9e-26 PF00581: Rhodanese" amino acids 138 to 231 (94 residues), 60.8 bits, see alignment E=2.3e-20 PF12368: Rhodanese_C" amino acids 246 to 307 (62 residues), 79.4 bits, see alignment E=3e-26

Best Hits

Swiss-Prot: 92% identical to Y1569_ENT38: UPF0176 protein Ent638_1569 (Ent638_1569) from Enterobacter sp. (strain 638)

KEGG orthology group: K07146, UPF0176 protein (inferred from 97% identity to enc:ECL_02584)

MetaCyc: 88% identical to tRNA U34 hydroxylase TrhO (Escherichia coli K-12 substr. MG1655)
RXN0-7349

Predicted SEED Role

"Rhodanese domain protein, Enterobacterial subgroup, YceA homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>EX28DRAFT_1876 Predicted sulfurtransferase (Enterobacter asburiae PDN3)
MPVLHNRVSNEMLKARMLAETEPRTTISFYKYFTIDDPQATRDALYQAFTALNVFGRVYL
AREGINAQISVPESKVSAFRDVLYQFDPALDGLRLNIALDDDGKSFWVLRMKVRERIVAD
GIDDPAFNAADVGEYLKAAEVNAMLDDPDAVFIDMRNHYEYEVGHFENAMEIPADTFREQ
LPKAVEMMQEHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGL
PVRFIGKNFVFDERMGERISEDVIAQCHQCGAPCDTHTNCKNDGCHLLFIQCPACAEKFN
GCCSELCSEESILPEEEQRRRRAGRENGNKIFNKSRGRLNTKLGIPDPE