Protein Info for EX28DRAFT_1824 in Enterobacter asburiae PDN3

Annotation: Predicted choline kinase involved in LPS biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 235 to 250 (16 residues), see Phobius details PF01636: APH" amino acids 37 to 228 (192 residues), 47.7 bits, see alignment E=8.7e-17

Best Hits

Swiss-Prot: 61% identical to THIK_SALPC: Thiamine kinase (thiK) from Salmonella paratyphi C (strain RKS4594)

KEGG orthology group: K07251, thiamine kinase [EC: 2.7.1.89] (inferred from 78% identity to enc:ECL_02530)

MetaCyc: 60% identical to thiamine kinase (Escherichia coli K-12 substr. MG1655)
Thiamine kinase. [EC: 2.7.1.89]

Predicted SEED Role

"Thiamine kinase (EC 2.7.1.89) @ Adenosylcobinamide kinase (EC 2.7.1.156)" (EC 2.7.1.156, EC 2.7.1.89)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.156 or 2.7.1.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>EX28DRAFT_1824 Predicted choline kinase involved in LPS biosynthesis (Enterobacter asburiae PDN3)
MRLRNNDSTREEILTRYFPQYRLIAPQAHSGLGGASCIIEQGERRLVLRQNHDPFAPASH
FRRQFRALRRLPSDLVPAPRFFRQGWMAVDYLDGEVKSALPDPPALASMLYHLHRQPRLG
WRTTLFPLLVHYWQQALPDRRTTVWLANLKRLRKTGEPQPIRLAPLHMDVHAGNIVHTPA
GIRLIDWEYAGDGDVALELAAVWTESEAARQMLIRDYARVAYIDPDALRRQVRRWRPWVI
MLMAGWFEMRYRQSRDKQFIALADDAWRQLQTKG