Protein Info for EX28DRAFT_1803 in Enterobacter asburiae PDN3

Annotation: peptidase T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 TIGR01882: peptidase T" amino acids 2 to 406 (405 residues), 531.5 bits, see alignment E=6.9e-164 PF01546: Peptidase_M20" amino acids 139 to 402 (264 residues), 63.7 bits, see alignment E=3.5e-21 PF07687: M20_dimer" amino acids 205 to 305 (101 residues), 57.5 bits, see alignment E=1.8e-19

Best Hits

Swiss-Prot: 92% identical to PEPT_ECOHS: Peptidase T (pepT) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K01258, tripeptide aminopeptidase [EC: 3.4.11.4] (inferred from 98% identity to enc:ECL_02508)

MetaCyc: 91% identical to peptidase T (Escherichia coli K-12 substr. MG1655)
Tripeptide aminopeptidase. [EC: 3.4.11.4]

Predicted SEED Role

"Tripeptide aminopeptidase (EC 3.4.11.4)" (EC 3.4.11.4)

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.4

Use Curated BLAST to search for 3.4.11.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>EX28DRAFT_1803 peptidase T (Enterobacter asburiae PDN3)
MDKLLERFLQYVSLDTQSKPGVRQVPSTEGQWKLLNLLKEQLDAMGLVNVTLSEKGTVMA
TLPANVQGDIPAIGFISHVDTSPDFSGKHVNPQIVENYRGGDIALGIGDEVLSPVMFPVL
HQLLGQTLITTDGKTLLGADDKAGIAEIMTALAVLKEKNIPHGDIRVAFTPDEEVGKGAK
HFDVEAFNAQWAYTVDGGGVGELEYENFNAASVTIKIVGNNVHPGSAKGVMVNALSLASR
IHAEVPAEESPEQTEGYEGFYHLTSIKGTVDSAQMHYIIRDFDRKAFEARKRKMMEIAKK
VGKGLHPDCYIELIIEDNYYNMREKVMAHPHILDIAQQAMRDCDIEPQLKPIRGGTDGSQ
LSFMGLPCPNLFTGGYNYHGKHEFVTLEGMEKAVKVIVRIAELTAKR