Protein Info for EX28DRAFT_1786 in Enterobacter asburiae PDN3

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF13185: GAF_2" amino acids 31 to 169 (139 residues), 45.9 bits, see alignment E=1e-15 PF01590: GAF" amino acids 33 to 168 (136 residues), 36.4 bits, see alignment E=1.1e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 187 to 350 (164 residues), 123.3 bits, see alignment E=4.2e-40 PF00990: GGDEF" amino acids 189 to 348 (160 residues), 124.2 bits, see alignment E=6.8e-40

Best Hits

Swiss-Prot: 66% identical to DGCP_ECOLI: Diguanylate cyclase DgcP (dgcP) from Escherichia coli (strain K12)

KEGG orthology group: K13069, diguanylate cyclase [EC: 2.7.7.65] (inferred from 80% identity to enc:ECL_02490)

MetaCyc: 66% identical to diguanylate cyclase DgcP (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"FIG00626844: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>EX28DRAFT_1786 diguanylate cyclase (GGDEF) domain (Enterobacter asburiae PDN3)
MQMQTSSAWESFYVMSDIILARVSETLATEQSLEGLVRQLLEMLEIVTDMESTYLTKVDI
EARLQHILYARNSKQMTIPEGLSVPWDETLCKRALDSDTVFSNDVPERWPECEAAKALGI
TTYMSIPVHLADGSLYGTLCATSTARKPLSERGEQVLKLFAGLIAQSIQKESLVTQLREA
NAALIAHSYTDALTGLPNRRAIFEDLTTLFSLARHLKRNTVIAFIDLDDFKLINDRYGHE
AGDQFLIEVGKRLREEKRQDDIIGRLGGDEFLVASLSTSHSEGDNAQVTLVKTRLSACIA
GEYWLGSANLIYPGASVGVIEVDPRVTDPDSALRDADVAMYQDKKGKSKTRFLTMD