Protein Info for EX28DRAFT_1779 in Enterobacter asburiae PDN3

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 27 to 27 (1 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 112 to 145 (34 residues), see Phobius details PF04284: DUF441" amino acids 7 to 145 (139 residues), 152.4 bits, see alignment E=4.1e-49

Best Hits

Swiss-Prot: 98% identical to Y1667_ENT38: UPF0756 membrane protein Ent638_1667 (Ent638_1667) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 98% identity to ent:Ent638_1667)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>EX28DRAFT_1779 Predicted membrane protein (Enterobacter asburiae PDN3)
MFDPTLLILLALAALGFVSHNTTVAISILVLIIVRVTPLNTFFPWIEKQGLTIGIIILTI
GVMAPIASGTLPASTLLHSFVNWKSLVAIAVGIFVSWLGGRGVTLMSSQPSLVAGLLVGT
VLGVALFRGVPVGPLIAAGLVSLFIGKS