Protein Info for EX28DRAFT_1765 in Enterobacter asburiae PDN3

Annotation: selenophosphate synthase (EC 2.7.9.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00476: selenide, water dikinase" amino acids 7 to 313 (307 residues), 446.2 bits, see alignment E=3e-138 PF00586: AIRS" amino acids 50 to 157 (108 residues), 90.3 bits, see alignment E=1.1e-29 PF02769: AIRS_C" amino acids 169 to 341 (173 residues), 69 bits, see alignment E=5.6e-23

Best Hits

Swiss-Prot: 95% identical to SELD_ENT38: Selenide, water dikinase (selD) from Enterobacter sp. (strain 638)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 98% identity to enc:ECL_02462)

MetaCyc: 89% identical to selenide, water dikinase (Escherichia coli K-12 substr. MG1655)
Selenide, water dikinase. [EC: 2.7.9.3]

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3)" in subsystem Selenocysteine metabolism (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>EX28DRAFT_1765 selenophosphate synthase (EC 2.7.9.3) (Enterobacter asburiae PDN3)
MSEQTIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSIISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINTIPPEVARE
VIDGGRFACQQAGIALAGGHSIDAPEPIFGLAVTGVVPTERVKRNSTAQAGCKLFLTKPL
GIGVLTTAEKKSLLKPEHKGLATEVMCQMNLAGAAFANIDGVKAMTDVTGFGLLGHLSEV
CQGAGVQAQVWYQDVPKLPGVEEYIAQGAVPGGTQRNFASYGHLMGEMPEEWRNLLCDPQ
TSGGLLLAVTPESEAEVQATAAEFGITLTAIGELVTARGGRPMIEIR