Protein Info for EX28DRAFT_1745 in Enterobacter asburiae PDN3

Annotation: GIY-YIG catalytic domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF27096: UvrC_M" amino acids 126 to 216 (91 residues), 72.5 bits, see alignment E=3.4e-24 PF27115: Cho_C" amino acids 232 to 297 (66 residues), 64.7 bits, see alignment E=5.4e-22

Best Hits

Swiss-Prot: 76% identical to CHO_ECOLI: Excinuclease cho (cho) from Escherichia coli (strain K12)

KEGG orthology group: K05984, excinuclease Cho [EC: 3.1.25.-] (inferred from 91% identity to enc:ECL_02442)

Predicted SEED Role

"Excinuclease cho (excinuclease ABC alternative C subunit)" in subsystem DNA repair, UvrABC system

Isozymes

Compare fitness of predicted isozymes for: 3.1.25.-

Use Curated BLAST to search for 3.1.25.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>EX28DRAFT_1745 GIY-YIG catalytic domain (Enterobacter asburiae PDN3)
MSEQYMEQYVSRRQSAPRLEFEAAAIYEYPEHLRPWLEALPKQPGVYIFHGESDTLPLYI
GKSVNIRSRVLSHLRTPDEAAMLRQSRRITWFQTAGEMGALLLEARLIKEQQPLFNKRLR
RNRQLCSLQINNGKPQVVYARDVDFSHAPNLYGLFANKRAALQALQTLADDLQLCYSLLG
LEATTRGRACFRSALKRCAGACCGKESVEAHHARLLTGLAAISVNCWPWESAVALKEVGE
AMTQYHIVNNWLWLGAVDDINDAATLLRTPAGFDHDGYKILCKPVLAGKFEIIVLNDPAA
T