Protein Info for EX28DRAFT_1744 in Enterobacter asburiae PDN3

Annotation: NAD+ synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00552: NAD+ synthetase
  • amino acids 18 to 275 (258 residues), 279.6 bits, E=9.7e-88
• PF02540: NAD_synthase
  • amino acids 23 to 265 (243 residues), 253.7 bits, E=6.9e-80

Best Hits

Swiss-Prot: 90% identical to NADE_ENT38: NH(3)-dependent NAD(+) synthetase (nadE) from Enterobacter sp. (strain 638)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 96% identity to enc:ECL_02441)

MetaCyc: 87% identical to NH3-dependent NAD+ synthetase (Escherichia coli K-12 substr. MG1655)
NAD(+) synthase. [EC: 6.3.1.5]

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
• NAD de novo biosynthesis III (4/6 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Protein Sequence (275 amino acids)

>EX28DRAFT_1744 NAD+ synthetase (Enterobacter asburiae PDN3)
MALQQEIIQALGAKPTVDAHEEIRRSVDFLKSYLKKNAFLKSLVLGISGGQDSTLTGKLC
QMAISELREETGDEKLQFIAVRLPYGVQADEQDCQDAITFIQPDRVLTVNIKGSVLASEQ
ALREAGIELSDFVRGNEKARERMKAQYSIAGMTKGVVVGTDHAAEAITGFFTKYGDGGTD
INPIFRLNKRQGKQLLAALGCPEHLYKKAPTADLEDDRPSLPDEAALGVTYDNIDDYLEG
KKLDEGTAKIIEGWYLKTEHKRHTPITVFDDFWKK