Protein Info for EX28DRAFT_1737 in Enterobacter asburiae PDN3

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF04794: YdjC" amino acids 5 to 238 (234 residues), 189.9 bits, see alignment E=4.5e-60

Best Hits

Swiss-Prot: 79% identical to CHBG_ENT38: Chitooligosaccharide deacetylase (chbG) from Enterobacter sp. (strain 638)

KEGG orthology group: K03478, hypothetical protein (inferred from 88% identity to enc:ECL_02434)

MetaCyc: 71% identical to chitooligosaccharide monodeacetylase ChbG (Escherichia coli K-12 substr. MG1655)
3.5.1.-

Predicted SEED Role

"Cellobiose phosphotransferase system YdjC-like protein" in subsystem Beta-Glucoside Metabolism

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>EX28DRAFT_1737 Uncharacterized protein conserved in bacteria (Enterobacter asburiae PDN3)
MENLLIVNADDFGLSKGQNYGIIEACRRGVVTSTTALVNGEAVEHAAQLSREVPELGVGM
HFVLTLGMPLSPMPGLTRDGQLGKWIWELAEQDALPLEEIAGELERQFNRFIDAFGKAPT
HIDSHHHVHMIPAIFPIVAEFAQRKGVAMRVDRGASSVPDCAVTTTEGFSSAFYGDKIDE
ALFLKVLDGSAARGEKSLEVMAHPAFVDNTVRKSAYCWPRLAELDVLTSASLKYAIAERG
YRLGTFRDL