Protein Info for EX28DRAFT_1718 in Enterobacter asburiae PDN3

Annotation: ABC-type cobalamin transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 58 to 81 (24 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 234 to 260 (27 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF01032: FecCD" amino acids 22 to 323 (302 residues), 284 bits, see alignment E=6.8e-89

Best Hits

Swiss-Prot: 76% identical to BTUC_SALPA: Vitamin B12 import system permease protein BtuC (btuC) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K06073, vitamin B12 transport system permease protein (inferred from 85% identity to ent:Ent638_1731)

MetaCyc: 76% identical to vitamin B12 ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>EX28DRAFT_1718 ABC-type cobalamin transport system, permease component (Enterobacter asburiae PDN3)
MLDYAHRQHRSDKRRLFLLVMLLIVAAGASLCAGDRWIGPESWWGPDGQLFVWQIRLPRT
VAVVLVGAALALCGTIMQALFDNPLAEPGLLGVSNGAGVGLIAAVMLGGGELSGWSISLS
AILGALLITAILLRFARRHLSTSRLLLAGVALGIICSALMTWAVYFSTSFDLRQLMYWMM
GGFGGVDWHQGWLMALLVPVIVWAALQAQPLNMLALGETSARQLGMPIGFWRNVLVIAIG
WLVGVSVALAGAIGFIGLVIPHMLRLCGLTDHRTLLPASAVAGAVTLLVADIIARLALTA
AELPIGVVTATLGAPVFIWLLLKAGR