Protein Info for EX28DRAFT_1711 in Enterobacter asburiae PDN3

Annotation: H+/gluconate symporter and related permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 57 to 79 (23 residues), see Phobius details amino acids 98 to 127 (30 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 437 to 460 (24 residues), see Phobius details

Best Hits

Swiss-Prot: 56% identical to YXJC_BACSU: Uncharacterized transporter YxjC (yxjC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 98% identity to enc:ECL_02405)

Predicted SEED Role

"D-beta-hydroxybutyrate permease" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>EX28DRAFT_1711 H+/gluconate symporter and related permeases (Enterobacter asburiae PDN3)
MSVLIALAALALLMLAAYRGYSVILFAPIAALGAVLLTDPGAVGPTFTGLFMEKMVGFVK
LYFPVFLLGAVFGKLIELSGFSRSIVAAAIQILGRRHAIPVIVLVCALLTYGGVSLFVVA
FAVYPFAAELFRQSGIPKRLIPATVALGAFSFTMDALPGTPQIQNIIPTSFFGTNAWAAP
WLGLIGSLFIIVFGLLWLERQRRKAFNNNEGYGTDLKNEPETPDNINLPHPLIAISPLLV
VGILNLLFTRWIPGWYGTTHELTLPGLAKPIVTEVGKITAIWAVEAALISGIVLVLIFGF
HNIRGRLAEGSRTAVSGAILAAMNTASEYGFGAVIAALPGFLVLSKALAAIPNPLLNEAI
SVTVLAGITGSASGGMSIALAAMSDSFVAAAHAANIPLEVLHRVASMASGGMDTLPHNGA
VITLLAITGLSHRQAYGGIFAITIIKSLAVLFVIAVFYLTGIV