Protein Info for EX28DRAFT_1670 in Enterobacter asburiae PDN3

Annotation: ABC-type polar amino acid transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF00005: ABC_tran" amino acids 39 to 188 (150 residues), 128.8 bits, see alignment E=2.3e-41 PF13304: AAA_21" amino acids 158 to 219 (62 residues), 30.2 bits, see alignment E=4.6e-11

Best Hits

Swiss-Prot: 55% identical to GLUA_CORGL: Glutamate transport ATP-binding protein GluA (gluA) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: K10041, putative glutamine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 86% identity to ent:Ent638_1778)

MetaCyc: 54% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>EX28DRAFT_1670 ABC-type polar amino acid transport system, ATPase component (Enterobacter asburiae PDN3)
MLSGLFSHSAAGAADFSHLEQASVEFRHVDKRYGDHQVLNDINLTITPGEVVAILGPSGS
GKSTLIRLINQLETLSGGEILVDNKPTGKLSGSGLRQLRSRVGFVFQQFNLYAHLTASQN
ITLALEHVHGWKPQPAQERALALLEKVGMLEKAHHFPAELSGGQQQRVAIARALASSPQI
ILFDEPTSALDPEMIGEVLYVMKALAHSGITMIVVTHEMQFAREIADRIVFIDGGQILET
APPAQFFSQPSHPRAQRFLQKVLNPLHQEHL